Visar bild 1 av
1
Human Novel Coronavirus Spike glycoprotein(S) 100 µg
Product no: AS20 4389-100
AS20 4389 | Recombinant protein (positive control)
502
€
Delivery:
3-6 business days
- Product Info
-
Format: Lyophilized Storage: Store lyophilized/reconstituted at -20°C/-80°C. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Working aliquotes can be stored at 4℃ for up to one week.Shelf life of liquid form is 6 monthss at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Tested applications: ELISA (ELISA) - Application Examples
-
Application example 
Functional ELISA showing binding ability. Wells were coated with SARS-CoV-2-S at 2 μg/ml which can bind SARS-CoV-2-S Antibody (AS20 4386), the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml
Recombinant Human Novel Coronavirus Spike glycoprotein (S) was separated on Tris-Glycine gradient SDS-PAGE in reduced conditions. Calculated MW of a target protein is 79.6 kDa, however it migrates at 116 kDa in applied conditions due to glycosylation. - Additional Information
-
Additional information (application): N-terminal His tagged Spike glycoprotein (S) (10xHis) and C-terminal FLAG-tagged, was overexpressed in HEK293 mammalian cells using transfection reagent, in the region 16-685 amino acids UniProt: P0DTC2
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVS
GTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNV
VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL
EGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINI
TRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVD
CALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR
FASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY
RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQP
YRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF
QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN
CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGI
CASYQTQTNSPRRAR
Purity: >85 % as confirmed by SDS-PAGE
Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 - Background
-
Background: SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human) its role is to attache the virion to the cell membrane by interacting with host receptor (ACE2) and initiating the infection.
Alternative names: S, S1, S1-RBD, Spike glycoprotein. - Protocols
- Antibody protocols
- Reviews:
-
This product doesn't have any reviews.
Accessories
AS20 4386 | Clonality: Recombinant Monoclonal | Host: Mouse | Reactivity: S protein Human SARS-CoV-2/ 2019-nCoV
382 €
Buy 2 items of this product for 253.00 €/items
Buy 3 items of this product for 205.00 €/items
AS15 TMB-HRP | TMB based, especially formulated with extreme sensitivity, HRP substrate for microwell application.
- 10ml trial size is restricted to one unit per customer -
- 10ml trial size is restricted to one unit per customer -
From 11 €
AS20 4390 | Clonality: Polyclonal | Host: Goat | Reactivity: Human IgG Fcγ (gamma chain)
167 €
AS20 4387 | Clonality: Recombinant Monoclonal | Host: Mouse | Reactivity: Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV
382 €
Buy 2 items of this product for 253.00 €/items
Buy 3 items of this product for 205.00 €/items