Name:
Phone:
E-mail:
Address:






ACT | Actin (protein)

AS16 4111S   |  Protein/positive control

ACT | Actin (protein) in the group Antibodies Plant/Algal  / Loading Controls at Agrisera AB (Antibodies for research) (AS16 4111S)
ACT | Actin (protein)



DATA SHEET IN PDF

Qty: 
123
How to cite this product:
Product name, number (Agrisera, Sweden)

Data sheet Product citations Protocols Add review

Product Information

Purity Purity >95 %.
Format Liquid at 3,3 mg/ml.
Quantity 100 ĩg
Storage Store at -20°C.Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Tested applications Western blot (WB)

Reactivity

Application examples

Additional information

This protein can be used as a standard to calibrate for western blot.

Related products

Related products AS16 4111 | Anti-actin, mouse monoclonal antibodies
AS13 2640 | Anti-actin, rabbit polyclonal antibodies

Background

Background His-tagged recombinant actin, sequence: GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
RGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQP
SLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKV
VAPPER

Product citations

Related products: ACT | Actin (protein)

AS13 2640 | Clonality: Polyclonal | Host: Rabbit | Reactivity: Agostis stoloniferacv. ‘Penn...
292 €
Buy 2 items of this product for 218.00 €/items
Buy 3 items of this product for 198.00 €/items
AS16 ECL-N |  low pico to mid femtogram detection

This product can be purchased in 3 ...
From 12 €
AS16 4111   | Clonality:  Monoclonal |  Host:  Mouse | Reactivity: Arabid...
AS09 602 |  Clonality: Polyclonal | Host: Goat | Reactivity: Rabbit IgG (H&L)
194 €