ACT | Actin (protein)

Product no: AS16 4111S

AS16 4111S   |  Protein/positive control

127
Add to cart
Delivery:  3-6 business days
  • Product Info
  • Purity: Purity >95 %.
    Format: Liquid at 3,3 mg/ml.
    Quantity: 100 g
    Storage: Store at -20C.Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
    Tested applications: Western blot (WB)
  • Additional Information
  • Additional information (application): This protein can be used as a standard to calibrate for western blot.
  • Background
  • Background: His-tagged recombinant actin, sequence: GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
    RGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQP
    SLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKV
    VAPPER
  • Protocols
  • Agrisera Western Blot protocol and video tutorials

    Protocols to work with plant and algal protein extracts

    Agrisera Educational Posters Collection
  • Reviews:
  • Reviews
    Below, you can grade the product on a scale from 0 to 5.
    Please also provide information about species, application, dilution and obtained result for the reviewed antibody.
    Your name will be displayed as the sender.
    Number of reviews: (0)

    This product doesn't have any reviews.

Accessories

AS09 602 |  Clonality: Polyclonal | Host: Goat | Reactivity: Rabbit IgG (H&L)

10 % until end of 2023. Use discount code: Conj10

201 €
Add to cart
Info

AS13 2640 | Clonality: Polyclonal | Host: Rabbit | Reactivity: Agostis stoloniferacv. ‘Penncross’,Arabidopsis thaliana, Brassica sp., Cannabis sativa L., Cucumis sativus, Cynara cardunculus, Glycine max, Hordeum vulgare, Nicotiana tabacum, Phaseolus vulgaris, Phoenix dactylifera, Picrorhiza kurroa, Setaria italica, Solanum tuberosum, Triticum aestivum, Zea mays

302 €
Add to cart
Info
Buy 2 items of this product for 226.00 €/items
Buy 3 items of this product for 205.00 €/items
img missing
AS16 ECL-N |  low pico to mid femtogram detection

This product can be purchased in 3 different volumes:

AS16 ECL-N-10, 10 ml. Trial size limited to one per customer

AS16 ECL-N-100, 100 ml

AS16 ECL-N-1L, 1L

Choose the appropriate volume in the drop down menu to the right

From 12 €
Close