Name:
Phone:
E-mail:
Message


 


ACT | Actin (protein)

AS16 4111S   |  Protein/positive control

ACT | Actin (protein) in the group Antibodies for Plant/Algal  / Loading Controls at Agrisera AB (Antibodies for research) (AS16 4111S)

DATA SHEET IN PDF

Qty: 
120
How to cite this product:
Product name, number (Agrisera, Sweden)

Data sheet Product citations Protocols Add review

Product Information

Purity Purity >95 %
Format

Liquid at 3.3 mg/ml

Quantity

 100 µg

Storage

Store at -20°C.
Make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tubes.

Tested applications Western blot (WB)

Reactivity

Application examples

Additional information

This protein can be used as a standard to calibrate for western blot.

Related products

Related products AS16 4111 | Anti-actin, mouse monoclonal antibodies
AS13 2640 | Anti-actin, rabbit polyclonal antibodies

Background

Background His-tagged recombinant actin, sequence: GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
RGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQP
SLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKV
VAPPER

Product citations

Related products: ACT | Actin (protein)

AS16 4111   | Clonality:  Monoclonal |  Host:  Mouse | Reactivity: Arabid...
360 €
AS13 2640 | Clonality: Polyclonal | Host: Rabbit | Reactivity: Agostis stoloniferacv. ‘Penn...
286 €
Buy 2 items of this product for 214.00 €/items
Buy 3 items of this product for 195.00 €/items
AS16 ECL-N |  low pico to mid femtogram detection
- 10ml trial size is restricted to on...
From 9 €
AS09 602 |  Clonality: Polyclonal | Host: Goat | Reactivity: Rabbit IgG (H&L)
190 €