ACT | Actin (protein)
AS16 4111S | Protein/positive control
- Product Info
-
Purity: Purity >95 %. Format: Liquid at 3,3 mg/ml. Quantity: 100 µg Storage: Store at -20°C.Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Tested applications: Western blot (WB) - Additional Information
-
Additional information (application): This protein can be used as a standard to calibrate for western blot. - Background
-
Background: His-tagged recombinant actin, sequence: GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
RGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQP
SLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKV
VAPPER - Protocols
-
Agrisera Western Blot protocol and video tutorials
Protocols to work with plant and algal protein extracts
Agrisera Educational Posters Collection
- Reviews:
-
This product doesn't have any reviews.
Accessories
AS09 602 | Clonality: Polyclonal | Host: Goat | Reactivity: Rabbit IgG (H&L)
AS13 2640 | Clonality: Polyclonal | Host: Rabbit | Reactivity: Agostis stoloniferacv. ‘Penncross’,Arabidopsis thaliana, Brassica sp., Cannabis sativa L., Cucumis sativus, Cynara cardunculus, Glycine max, Hordeum vulgare, Nicotiana tabacum, Phaseolus vulgaris, Phoenix dactylifera, Picrorhiza kurroa, Setaria italica, Solanum tuberosum, Triticum aestivum, Zea mays
This product can be purchased in 3 different volumes:
AS16 ECL-N-10, 10 ml. Trial size limited to one per customer
AS16 ECL-N-100, 100 ml
AS16 ECL-N-1L, 1L
Choose the appropriate volume in the drop down menu to the right