Human Novel Coronavirus Nucleoprotein(N)

Data sheet | Product citations | Protocols | Add review | List of articles |
Product Information
Make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes. Working aliquotes can be stored at 4℃ for up to one week.
Shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Reactivity
Application examples
Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000 and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.
Note: Predicted band size: 48 kDa Observed band size: 55 kDa
Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50 43.50-118.4 ng/ml.
Additional information
FTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSP
RWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQL
PQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG
GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAY
NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIG
MEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKA
DETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Purity: >90 % as confirmed by SDS-PAGE
Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Background
Alternative names: NC, Protein N, Nucleocapsid protein
Product citations
Related products: Human Novel Coronavirus Nucleoprotein(N)
This product can b...