Human Novel Coronavirus Nucleoprotein(N) 100 g

Product no: AS20 4388-100
AS20 4388 | Recombinant protein (positive control) for Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387
Add to cart
Delivery:  3-6 business days
  • Product Info
  • Format: Lyophilized
    Quantity: 100 g 1000 g
    Storage: Store lyophilized/reconstituted at -20C/-80C. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Working aliquotes can be stored at 4℃ for up to one week.Shelf life of liquid form is 6 monthss at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
    Tested applications: ELISA (ELISA), Western blot (WB)
  • Application Examples
  • Application examples

    Western blot using Novel Coronovirus Nucleoprotein (N)

    Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000  and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

    Note: Predicted band size: 48 kDa Observed band size: 55 kDa

    Nucleoprotein (N) ELISA

    Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50  43.50-118.4 ng/ml.

    Application examples

    Western blot using Novel Coronovirus Nucleoprotein (N)

    Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000  and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

    Note: Predicted band size: 48 kDa Observed band size: 55 kDa

    Nucleoprotein (N) ELISA

    Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50  43.50-118.4 ng/ml.

    Application examples

    Western blot using Novel Coronovirus Nucleoprotein (N)

    Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000  and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

    Note: Predicted band size: 48 kDa Observed band size: 55 kDa

    Nucleoprotein (N) ELISA

    Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC50  43.50-118.4 ng/ml.

  • Additional Information
  • Additional information (application): N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW

    This product is a positive control for Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387).

    Purity: >90 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW

    Purity: >90 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW

    Purity: >90 % as confirmed by SDS-PAGE
    Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 
  • Background
  • Background: Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).

    Alternative names:
    NC, Protein N, Nucleocapsid protein
  • Protocols
  • Antibody protocols
  • Reviews:
  • Reviews
    Below, you can grade the product on a scale from 0 to 5.
    Please also provide information about species, application, dilution and obtained result for the reviewed antibody.
    Your name will be displayed as the sender.
    Number of reviews: (0)

    This product doesn't have any reviews.


img missing

AS20 4390 | Clonality: Polyclonal  |  Host: Goat  | Reactivity: Human IgG Fcγ (gamma chain)

167 €
Add to cart
img missing

AS20 4387   | Clonality: Recombinant Monoclonal |  Host: Mouse | Reactivity: Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV

382 €
Add to cart
Buy 2 items of this product for 253.00 €/items
Buy 3 items of this product for 205.00 €/items
img missing

AS20 4386   | Clonality: Recombinant Monoclonal |  Host: Mouse | Reactivity: S protein Human SARS-CoV-2/ 2019-nCoV 

382 €
Add to cart
Buy 2 items of this product for 253.00 €/items
Buy 3 items of this product for 205.00 €/items