Human Novel Coronavirus Nucleoprotein(N)

AS20 4388 | Recombinant protein (positive control) for Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387)

DATA SHEET IN PDF

Product size:
Qty:

Add review

Customer's grade at Human Novel Coronavirus Nucleoprotein(N) in the group Antibodies for Human/Animal / Coronavirus Research at Agrisera AB (Antibodies for research)

How to cite this product:
Product name, number (Agrisera, Sweden)

campaign:

Quantity:

campaign Start:

campaign Stop:

Product Information

Format Lyophilized

Storage Store lyophilized/reconstituted at -20℃/-80℃. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration.

Make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes. Working aliquotes can be stored at 4℃ for up to one week.

Shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Tested applications ELISA (ELISA), Western blot (WB)

Reactivity

Application examples

Application examples Application examples

Western blot using Novel Coronovirus Nucleoprotein (N)

Western blot using 200 ng/well of His tag-tagged SARS-CoV-2 nucleocapsid recombinant protein overexpressed in E. coli, detected by anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387) used at 1:1000 and combined with Goat Anti-Human IgG, Fcγ Fragment Specific, HRP conjugated secondary antibodies (AS20 4390) at 1: 20 000. Reaction was visualised with chemiluminescent detection reagent according to manufacture's recommendations.

Note: Predicted band size: 48 kDa Observed band size: 55 kDa

Nucleoprotein (N) ELISA

Functional ELISA of immobilized Nucleoprotein (N) at 5 μg/ml which can bind anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387), with the EC₅₀ 43.50-118.4 ng/ml.

Additional information

N-terminal His tagged Nucleoprotein (N) (6xHis) was overexpressed in E.coli in the region 1-419 amino acids UniProt P0DTC9: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASW
FTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSP
RWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQL
PQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNG
GDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAY
NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIG
MEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKA
DETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

This product is a positive control for Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) antibodies (AS20 4387).

Purity: >90 % as confirmed by SDS-PAGE
Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Related products

Related products AS20 4387 | Anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human), mouse recombinant antibodies
AS20 4386 | Anti-SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human), mouse recombinant antibodies
AS20 4390 | Goat anti-Human IgG Fcy, HRP conjugated, secondary antibodies

Background

Background Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).

Alternative names: NC, Protein N, Nucleocapsid protein