Transthyretin 56-61, amyloid specific (mouse monoclonal)

Product no: AS16 3113

AS16 3113   | clonality: monoclonal  |  host: mouse  |  reactivity: human

373
Add to cart
Delivery:  3-6 business days
  • Product Info
  • Immunogen: Recombinant protein corresponding to the Human wild type Transthyretin. GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELH
    GLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYS
    YSTTAVVTNPKE The epitope has been mapped to residue 56-61
    Sub class: IgG1
    Host: Mouse
    Clonality: Monoclonal
    Purity: Affinity purified in PBS pH 7.4.
    Format: Lyophilized
    Quantity: 100 g
    Reconstitution: Add 100 l sterile water to reconstitute to 1 mg/ml
    Storage: Store lyophilized/reconstituted at 4C, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
    Tested applications: ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
    Recommended dilution: 1:1000 (ELISA), 1:500 (IHC), 1:1000 (WB)
    Expected | apparent MW: 155
  • Reactivity
  • Confirmed reactivity: Human Transthyretin Amyloids
    Not reactive in: No confirmed exceptions from predicted reactivity are currently known
  • Additional Information
  • Additional information (application): Specifically reactive to the amyloid form of human Transthyretin. Epitope mapped to residue 56-61 which remains buried within the native fold of transthyretin but becomes exposed within its amyloid form.
    It has been suggested that that two distinct mechanisms of TTR-amyloidosis exists. The first, most common seen in wild type TTR Amyloidosis, consists of the full length TTR. Whereas the other type of amyloidosis mainly consists of the C-terminal region of the protein and is more common in mutant versions of TTR. Mouse IgG1 Anti-Transthyretin 56-61 (Amyloid Specific) epitope is located at the C-terminal strand of cleaved TTR and is suitable to detect amyloid formation derived from the C-terminal.
  • Background
  • Background: Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.

    Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.
  • Product Citations
  • Selected references: Goldsteins et al. (1999). Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants. Proc Natl Acad Sci U S A. 1999 Mar 16; 96(6): 3108–3113
  • Protocols
  • Antibody protocols
  • Reviews:
  • Reviews
    Below, you can grade the product on a scale from 0 to 5.
    Please also provide information about species, application, dilution and obtained result for the reviewed antibody.
    Your name will be displayed as the sender.
    Number of reviews: (0)

    This product doesn't have any reviews.

Accessories

img missing
AS15 TMB-HRP | TMB based, especially formulated with extreme sensitivity, HRP substrate for microwell application.
- 10ml trial size is restricted to one unit per customer -
From 11 €

AS09 627 | Clonality: Polyclonal  |  Host: Rabbit  | Reactivity: Mouse IgG (H&L)

218 €
Add to cart
Info
Close