Transthyretin 56-61, amyloid specific (mouse monoclonal)

AS16 3113 | clonality: monoclonal | host: mouse | reactivity: human

Product Information

Immunogen Recombinant protein corresponding to the Human wild type Transthyretin. GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELH
GLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYS
YSTTAVVTNPKE The epitope has been mapped to residue 56-61

Host Mouse

Clonality Monoclonal

Subclass/isotype IgG1

Purity Affinity purified in PBS pH 7.4.

Format Lyophilized

Quantity 100 µg

Reconstitution Add 100 µl sterile water to reconstitute to 1 mg/ml

Storage Store lyophilized/reconstituted at 4°C, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.

Tested applications ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)

Recommended dilution 1:1000 (ELISA), 1:500 (IHC), 1:1000 (WB)

Expected | apparent MW 155

Reactivity

Confirmed reactivity Human Transthyretin Amyloids

Not reactive in No confirmed exceptions from predicted reactivity are currently known

Application examples

Additional information

Specifically reactive to the amyloid form of human Transthyretin. Epitope mapped to residue 56-61 which remains buried within the native fold of transthyretin but becomes exposed within its amyloid form.
It has been suggested that that two distinct mechanisms of TTR-amyloidosis exists. The first, most common seen in wild type TTR Amyloidosis, consists of the full length TTR. Whereas the other type of amyloidosis mainly consists of the C-terminal region of the protein and is more common in mutant versions of TTR. Mouse IgG1 Anti-Transthyretin 56-61 (Amyloid Specific) epitope is located at the C-terminal strand of cleaved TTR and is suitable to detect amyloid formation derived from the C-terminal.

Background

Background Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.

Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.

Product citations

Selected references Goldsteins et al. (1999). Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants. Proc Natl Acad Sci U S A. 1999 Mar 16; 96(6): 3108–3113

Confirmed reactivity:	Human Transthyretin Amyloids
not reactive in:	No confirmed exceptions from predicted reactivity are currently known
additional information (application):	Specifically reactive to the amyloid form of human Transthyretin. Epitope mapped to residue 56-61 which remains buried within the native fold of transthyretin but becomes exposed within its amyloid form. It has been suggested that that two distinct mechanisms of TTR-amyloidosis exists. The first, most common seen in wild type TTR Amyloidosis, consists of the full length TTR. Whereas the other type of amyloidosis mainly consists of the C-terminal region of the protein and is more common in mutant versions of TTR. Mouse IgG1 Anti-Transthyretin 56-61 (Amyloid Specific) epitope is located at the C-terminal strand of cleaved TTR and is suitable to detect amyloid formation derived from the C-terminal.
calculated \| apparent molecular mass [kDa]:	155
Clonality:	Monoclonal
Format:	Lyophilized
Host:	Mouse
immunogen:	Recombinant protein corresponding to the Human wild type Transthyretin. GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELH GLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYS YSTTAVVTNPKE The epitope has been mapped to residue 56-61
Purity:	Affinity purified in PBS pH 7.4.
Quantity:	100 µg
recommended dilution:	1:1000 (ELISA), 1:500 (IHC), 1:1000 (WB)
Reconstitution:	Add 100 µl sterile water to reconstitute to 1 mg/ml
storage:	Store lyophilized/reconstituted at 4°C, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Sub class:	IgG1
tested applications:	ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
background:	Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart. Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.
All references:	Goldsteins et al. (1999). Exposure of cryptic epitopes on transthyretin only in amyloid and in amyloidogenic mutants. Proc Natl Acad Sci U S A. 1999 Mar 16; 96(6): 3108–3113

Related products: Transthyretin 56-61, amyloid specific (mouse monoclonal)

Agrisera ECL kit (Bright/SuperBright)

AS16 ECL-S-N | low pico to mid femtogram and extreme low femtogram detection

This product can b...

From 26 €

Info

Add to cart

AgriseraTMB HRP Substrate

AS15 TMB-HRP | TMB based, especially formulated with extreme sensitivity, HRP substrate for microw...

From 10 €

Info

Add to cart

Rabbit anti-Mouse IgG (H&L), HRP conjugated

AS09 627 | Clonality: Polyclonal | Host: Rabbit | Reactivity: Mouse IgG (H&L...

206 €