Name:
Phone:
E-mail:
Address:


 


Human Novel Coronavirus Spike glycoprotein(S)

AS20 4389 | Recombinant protein (positive control)
Human Novel Coronavirus Spike glycoprotein(S) in the group Antibodies for Human/Animal  / Coronavirus Research at Agrisera AB (Antibodies for research) (AS20 4389)

DATA SHEET IN PDF

Product size: 
Qty: 
How to cite this product:
Product name, number (Agrisera, Sweden)
campaign:
Quantity:
0
campaign Start:
campaign Stop:


Data sheet Product citations Protocols Add review List of articles

Product Information

Format Lyophilized
Storage Store lyophilized/reconstituted at -20℃/-80℃. Reconstitute in deionized sterile water to a concentration from 0.1-1.0 mg/ml and add 5-50% of glycerol (final concentration). 50 % glycerol is a default final recommended concentration.

Make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes. Working aliquotes can be stored at 4℃ for up to one week.

Shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Tested applications ELISA (ELISA)

Reactivity

Application examples

Application examples Application example

Functional ELISA for Human Novel Coronavirus Spike glycoprotein (S)

Functional ELISA showing binding ability. Wells were coated with  SARS-CoV-2-S at 2 μg/ml which can bind SARS-CoV-2-S Antibody (AS20 4386), the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml

Recombinant Human Novel Coronavirus Spike Glycoprotein (S)

Recombinant Human Novel Coronavirus Spike glycoprotein (S) was separated on Tris-Glycine gradient SDS-PAGE in reduced conditions. Calculated MW of a target protein is 79.6 kDa, however it migrates at 116 kDa in applied conditions due to glycosylation.

Additional information

N-terminal His tagged Spike glycoprotein (S) (10xHis) and C-terminal FLAG-tagged, was overexpressed in HEK293 mammalian cells using transfection reagent, in the region 16-685 amino acids UniProt: P0DTC2

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVS
GTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNV
VIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDL
EGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINI
TRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVD
CALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR
FASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY
RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQP
YRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF
QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN
CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGI
CASYQTQTNSPRRAR

Purity: >85 % as confirmed by SDS-PAGE
Buffer: 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Related products

Related products AS20 4386 | Anti-SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human), mouse recombinant antibodies
AS20 4387 | Anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human), mouse recombinant antibodies
AS20 4390 | Goat anti-Human IgG Fcy, HRP conjugated, secondary antibodies

Background

Background SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human) its role is to attache the virion to the cell membrane by interacting with host receptor (ACE2) and initiating the infection.

Alternative names: S, S1, S1-RBD, Spike glycoprotein.

Product citations

Related products: Human Novel Coronavirus Spike glycoprotein(S)

AS15 TMB-HRP | TMB based, especially formulated with extreme sensitivity, HRP substrate for microw...
From 10 €
AS20 4390 | Clonality: Polyclonal  |  Host: Goat  | Reactivity: Human IgG Fcγ ...
153 €
AS20 4387   | Clonality: Recombinant Monoclonal |  Host: Mouse | Reactivity: Nuclea...
255 €
Buy 2 items of this product for 178.00 €/items
AS20 4386   | Clonality: Recombinant Monoclonal |  Host: Mouse | Reactivity: S protein H...
255 €
Buy 2 items of this product for 178.00 €/items